PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01553.1.p
Common NameEUGRSUZ_J01553, LOC104423700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 173aa    MW: 20325.3 Da    PI: 10.9895
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01553.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.8e-181158148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd ll  +v+++G g W++++++ g++R++k+c++rw++yl
  Eucgr.J01553.1.p 11 KGSWTEEEDVLLRSCVQRYGEGEWHRVPQRAGLNRCRKSCRLRWLNYL 58
                      799*******************************************97 PP

2Myb_DNA-binding46.48.8e-1564108147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++  +E + +++++k+lG++ W++Ia +++ gRt++++k++w+++
  Eucgr.J01553.1.p  64 RGKFQDDEVDMIIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTH 108
                       8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.943662IPR017930Myb domain
SuperFamilySSF466894.12E-288105IPR009057Homeodomain-like
SMARTSM007171.2E-141060IPR001005SANT/Myb domain
PfamPF002494.5E-171158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-221265IPR009057Homeodomain-like
CDDcd001671.81E-101358No hitNo description
SMARTSM007171.4E-1363111IPR001005SANT/Myb domain
PROSITE profilePS5129418.48563113IPR017930Myb domain
PfamPF002492.1E-1364108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2366111IPR009057Homeodomain-like
CDDcd001672.78E-969108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MQKGSSFGFR KGSWTEEEDV LLRSCVQRYG EGEWHRVPQR AGLNRCRKSC RLRWLNYLKP  60
NIKRGKFQDD EVDMIIRLHK LLGNRWSLIA GRLPGRTAND VKNYWNTHQR KLMTYQGKPE  120
TKKPQDLVKV EVIRPRPRTI SRNFSSLGVE AYRELNESRE PRVHDVPPNR SP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22111147110B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01553.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM7730235e-93HM773023.1 Syzygium malaccense MYB transcription factor (MYB) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034461.11e-126PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV91e-63MY113_ARATH; Transcription factor MYB113
TrEMBLA0A059AE521e-126A0A059AE52_EUCGR; Uncharacterized protein
STRINGVIT_14s0006g01290.t012e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.18e-65myb domain protein 113